Total number of results for Carcinus maenas are 120
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00233 |
QLNFSPGW
|
8 | Carcinus maenas | AKH/HRTH/RPCH | Red pigment-concentrating hormone | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00356 |
AAPYAFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00357 |
AASPYSFGL
|
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00358 |
APGPYAFGL
|
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00359 |
ARPYAFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00360 |
ARPYSFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00361 |
EPYEFGL
|
7 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00362 |
FSGASPYGL
|
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00363 |
GKPYAFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00364 |
KLPYSFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00365 |
LKAYDFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00366 |
PADLYEFGL
|
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00367 |
RGPYAFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00368 |
TRPYSFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00369 |
AGWNKFQGSW
|
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00370 |
AWSNLGQAW
|
9 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00371 |
GSNWSNLRGAW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00372 |
GVNWSNLRGAW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00373 |
NNNWSKFQGSW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00374 |
NNWSKFQGSW
|
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00375 |
QWSSMRGAW
|
9 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00376 |
SGKWSNLRGAW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00377 |
STNWSSLRSAW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00378 |
TSWGKFQGSW
|
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00379 |
VPNDWAHFRGSW
|
12 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00380 |
VTWGKFQGSW
|
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00381 |
GGPYSXGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-16 | 9461295#Duve H, Johnsen AH, Maestro JL, Scott AG, Jaros PP, Thorpe A#Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas#Eur J Biochem 1997 Dec 15;250(3):727-34 | |
| NP00519 |
APQPYAFGL
|
9 | Carcinus maenas | Allatostatin | Carcinustatin-10 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00520 |
ATGQYAFGL
|
9 | Carcinus maenas | Allatostatin | Carcinustatin-11 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00521 |
PDMYAFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-12 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00522 |
EYDDMYTEKRPKVYAFGL
|
18 | Carcinus maenas | Allatostatin | Carcinustatin-13 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00523 |
YSFGL
|
5 | Carcinus maenas | Allatostatin | Carcinustatin-14 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00524 |
AGPYSFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-15 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00525 |
GGPYSYGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-16 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00526 |
SGQYSFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-17 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00527 |
SDMYSFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-18 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00528 |
APTDMYSFGL
|
10 | Carcinus maenas | Allatostatin | Carcinustatin-19 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00529 |
EAYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-2 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00530 |
GYEDEDEDRPFYALGLGKRPRTYSFGL
|
27 | Carcinus maenas | Allatostatin | Carcinustatin-20 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00531 |
EPYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-3 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00532 |
DPYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-4 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00533 |
NPYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-5 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00534 |
YAFGL
|
5 | Carcinus maenas | Allatostatin | Carcinustatin-1 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00535 |
SPYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-6 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00536 |
ASPYAFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-7 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00537 |
AGPYAFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-8 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00538 |
GGPYAFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-9 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00644 |
PSAALAVEHGTTHPLE
|
16 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00645 |
RSTPGYGRMDRIL
|
13 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00646 |
RSTPGYGRMDRILAA
|
15 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00647 |
RSTPGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLE
|
38 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00648 |
RSTQGYGRMDPIL
|
13 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00649 |
RSTQGYGRMDRILAA
|
15 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00650 |
RSTQGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLE
|
38 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00651 |
SPMEPSAALAVEHGTTHPLE
|
20 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00652 |
TSPMEPSAALAVEHGTTHPLE
|
21 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00684 |
RSTQGYGRMDRILAALKTSPMEPSAALAVENGTTHPLE
|
38 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991). | |
| NP00685 |
QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV
|
72 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 2792364# Kegel G., Reichwein B., Weese S., Gaus G., Peter-Katalinic J., Keller R.; #Amino acid sequence of the crustacean hyperglycemic hormone (CHH) from the shore crab, Carcinus maenas.; # FEBS Lett. 255:10-14(1989).$8841399#Chung J.S., Webster S.G.; #Does the N-terminal pyroglutamate residue have any physiological significance for crab hyperglycemic neuropeptides?; #Eur. J. Biochem. 240:358-364(1996). | |
| NP00686 |
RVINDECPNLIGNRDLYKKVEWICEDCSNIFRKTGMASLCRRNCFFNEDFVWCVHATERSEELRDLEEWVGILGAGRD
|
78 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | 1679945#Webster S.G.; #Amino acid sequence of putative moult-inhibiting hormone from the crab Carcinus maenas.; #Proc. R. Soc. B 244:247-252(1991). | |
| NP00766 |
NSELINSILGLPKVMNDA
|
18 | Carcinus maenas | Arthropod PDH | Pigment-dispersing hormone | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00893 |
PFCNAFTGC
|
9 | Carcinus maenas | CCAP | Cardioactive peptide | 16593803#Stangier J., Hilbich C., Beyreuther K., Keller R.; #Unusual cardioactive peptide (CCAP) from pericardial organs of the shore crab Carcinus maenas.; #Proc. Natl. Acad. Sci. U.S.A. 84:575-579(1987). | |
| NP01028 |
QTFQYSRGWTN
|
11 | Carcinus maenas | Corazonin | Corazonin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01445 |
APQGNFLRF
|
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01446 |
APQRNFLRF
|
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01447 |
DARTPALRLRF
|
11 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01448 |
DGNRNFLRF
|
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01449 |
DRNFLRF
|
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01450 |
EMPSLRLRF
|
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01451 |
GAHKNYLRF
|
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01452 |
GLSRNYLRF
|
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01453 |
NRNFLRF
|
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01454 |
NRSFLRF
|
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01455 |
QGNFLRF
|
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01456 |
RNFLRF
|
6 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01457 |
SENRNFLRF
|
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01458 |
SMPSLRLRF
|
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01459 |
SRNYLRF
|
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01460 |
YGNRSFLRF
|
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01461 |
GYRKPPFNGSIF
|
12 | Carcinus maenas | FMRFamide related peptide | SIFamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01462 |
RKPPFNGSIF
|
10 | Carcinus maenas | FMRFamide related peptide | SIFamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01463 |
VYRKPPFNGSIF
|
12 | Carcinus maenas | FMRFamide related peptide | SIFamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03061 |
QDLDHVFLRF
|
10 | Carcinus maenas | Myosuppressin | Myosuppressin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03343 |
KIFEPLR
|
7 | Carcinus maenas | NA | NA | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03344 |
KIFEPLRDKN
|
10 | Carcinus maenas | NA | NA | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03345 |
KIFEPLRDKNL
|
11 | Carcinus maenas | NA | NA | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03346 |
KIFEPLVA
|
8 | Carcinus maenas | NA | NA | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03347 |
HIGSLYR
|
7 | Carcinus maenas | NA | YRamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03522 |
RYLPT
|
5 | Carcinus maenas | NA | Proctolin | 2872661#Stangier J., Dircksen H., Keller R.; #Identification and immunocytochemical localization of proctolin in pericardial organs of the shore crab, Carcinus maenas.; #Peptides 7:67-72(1986). | |
| NP03808 |
PSLRLRF
|
7 | Carcinus maenas | NPY | Short neuropeptide F | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03809 |
PSMRLRF
|
7 | Carcinus maenas | NPY | Short neuropeptide F | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03989 |
EGFYSQRY
|
8 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03990 |
FVGGSRY
|
7 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03991 |
FYANRY
|
6 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03992 |
FYSQRY
|
6 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03993 |
SGFYADRY
|
8 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03994 |
SGFYAPRY
|
8 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03995 |
SSRFVGGSRY
|
10 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04260 |
EIDRSGFGFA
|
10 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04261 |
FDEIDRSGFGFA
|
12 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04262 |
NFDEIDRSGF
|
10 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04263 |
NFDEIDRSGFA
|
11 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04264 |
NFDEIDRSGFG
|
11 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04265 |
NFDEIDRSGFGF
|
12 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04266 |
NFDEIDRSGFGFA
|
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04267 |
NFDEIDRSGFGFN
|
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04268 |
NFDEIDRSGFGFV
|
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04269 |
NFDEIDRSSF
|
10 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04270 |
NFDEIDRSSFA
|
11 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04271 |
NFDEIDRSSFG
|
11 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04272 |
NFDEIDRSSFGFN
|
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04273 |
NFDEIDRSSFGFV
|
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04274 |
FDAFTTGFGHS
|
11 | Carcinus maenas | Orcokinin | Orcomyotropin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04962 |
DTGFAFSPRL
|
10 | Carcinus maenas | Pyrokinin | Pyrokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04963 |
LYFAPRL
|
7 | Carcinus maenas | Pyrokinin | Pyrokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04964 |
TSFAFSPRL
|
9 | Carcinus maenas | Pyrokinin | Pyrokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05556 |
APSGFLGMR
|
9 | Carcinus maenas | Tachykinin | Tachykinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05557 |
APSGFLGMRG
|
10 | Carcinus maenas | Tachykinin | Tachykinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05558 |
TPSGFLGMR
|
9 | Carcinus maenas | Tachykinin | Tachykinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05559 |
PSGFLGMR
|
8 | Carcinus maenas | Tachykinin | Tachykinin-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05560 |
SGFLGMR
|
7 | Carcinus maenas | Tachykinin | Tachykinin-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 |